Cat: PA2000-4577

Recombinant Human STRA6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    STRA6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    STRA6;Receptor for retinol uptake STRA6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BX79

  • Expression Region

    1-50aa

  • AA Sequence

    MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG

  • Molecular Weight

    33.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

STRA6 (Stimulated by Retinoic Acid 6) is a membrane-associated receptor primarily known for its role in retinol uptake and transport in cells. Research into STRA6 has gained significant attention due to its implications in various physiological processes and diseases. STRA6 functions as a receptor for retinol-binding protein (RBP), facilitating the delivery of retinol, a vitamin A derivative crucial for vision, cellular differentiation, and immune function. Abnormal STRA6 expression has been linked to several developmental disorders, particularly those affecting retinal development and function, such as retinitis pigmentosa. In addition, STRA6 is implicated in conditions like diabetes and certain cancers, where dysregulated retinol metabolism may contribute to disease progression. The recombinant expression and characterization of STRA6 protein enable researchers to explore its structure-function relationship, binding affinities, and potential as a therapeutic target. Understanding STRA6's mechanisms can illuminate new strategies for addressing vitamin A deficiency and its related health issues, making it a focus of ongoing biomedical research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US