Analytical Data
-
Gene name
IFNa5
- Application
-
Alternative Names
IFNa5；Interferon alpha-5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01569
-
Expression Region
1-189aa
-
AA Sequence
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
-
Molecular Weight
21.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interferon alpha 5 (IFNα5) is a member of the interferon family, known for its potent antiviral, anti-proliferative, and immunomodulatory effects. Research into IFNα5 is particularly significant due to its potential application in the treatment of various viral infections, autoimmune disorders, and certain cancers. The understanding of its molecular mechanisms and biological functions has advanced with recombinant DNA technology, enabling the production of IFNα5 as a therapeutic protein. The recombinant forms of IFNα5 can be engineered to enhance their stability, efficacy, and specificity, addressing the limitations seen with natural forms. As a part of the broader category of type I interferons, IFNα5 plays a crucial role in the innate immune response, influencing the activity of immune cells and modulating cytokine production. Investigating the signaling pathways and receptor interactions specific to IFNα5 not only helps in elucidating its therapeutic potential but also in overcoming challenges associated with other interferons, such as side effects and variable patient responses. The ongoing research aims to optimize the use of IFNα5 in clinical settings, assess its efficacy in various disease models, and explore combination therapies that could enhance its antitumor and antiviral effects. This is particularly relevant in the context of emerging viral threats and the need for novel therapeutic approaches in treating malignancies and chronic inflammatory conditions. Consequently, IFNα5 represents a promising avenue in modern immunotherapy, warranting continued exploration and clinical investigation.
