Cat: PA1000-1770

Recombinant Human LAMP3 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LAMP3

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LAMP3;DCLAMP;TSC403;Lysosome-associated membrane glycoProtein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P08962

  • Expression Region

    103-203aa

  • AA Sequence

    AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNV

  • Molecular Weight

    15.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LAMP3 (Lysosomal-associated membrane protein 3) is a member of the lysosomal membrane protein family, playing a vital role in lysosomal function, cellular homeostasis, and immune response. Recent studies have highlighted its significance in various physiological and pathological conditions, including cancer, neurodegenerative diseases, and infections. As a key player in the endosomal-lysosomal pathway, LAMP3 is involved in the processing and presentation of antigens, making it crucial for immune cell function. Its expression levels are altered in several diseases, suggesting that it may serve as a potential biomarker or therapeutic target. Researchers have been focusing on recombinant LAMP3 protein production to better understand its structure-function relationships and to explore its application in vaccine development and targeted therapies. This interest is driven by the need to elucidate LAMP3's role in disease mechanisms and to harness its properties for innovative treatments. The development of LAMP3-based research tools is also anticipated to contribute to the advancement of immunotherapy and personalized medicine approaches. Overall, the study of recombinant LAMP3 protein holds promise for unraveling its functional complexities and for potential applications in clinical settings.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US