Analytical Data
-
Gene name
ATXN2
- Application
-
Alternative Names
ATXN2；ATX2；SCA2；TNRC13；Ataxin-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99700
-
Expression Region
481-775aa
-
AA Sequence
REGHSINTRENKYIPPGQRNREVISWGSGRQNSPRMGQPGSGSMPSRSTSHTSDFNPNSGSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSF
-
Molecular Weight
37.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ATXN2, or Ataxin-2, is a protein encoded by the ATXN2 gene, and it plays a crucial role in various cellular processes, including RNA metabolism, stress granule formation, and neuronal function. Mutations or expansions in the CAG repeat region of the ATXN2 gene are associated with spinocerebellar ataxia type 2 (SCA2), a neurodegenerative disorder characterized by progressive ataxia. The research surrounding ATXN2 recombinant protein has gained significant attention due to its implications in disease pathology and potential therapeutic avenues. Studying the structure and function of ATXN2 can provide insights into the molecular mechanisms underlying SCA2 and other neurodegenerative diseases. Furthermore, recombinant ATXN2 can be utilized in biochemical assays, helping to identify potential interactors and elucidate its role in neuronal health. Understanding the dynamics of ATXN2 also contributes to broader research on polyglutamine diseases, as it can reveal common pathways involved in neurodegeneration. Overall, the exploration of ATXN2 recombinant protein stands as a pivotal area of research in molecular biology and neurodegeneration, opening up prospects for targeted treatments and better understanding of the intricate networks involved in neuronal homeostasis.
