Analytical Data
-
Gene name
DR5
- Application
-
Alternative Names
DR5；DRD1B；DRD1L2；D(1B) dopamine receptor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14763
-
Expression Region
54-210aa
-
AA Sequence
ALITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDY STHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMC RKCRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSSPG TPASPCS
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DR5, also known as death receptor 5, is a member of the tumor necrosis factor receptor (TNFR) superfamily and plays a crucial role in mediating apoptosis in cancer cells through its interaction with its ligand, TRAIL (TNF-related apoptosis-inducing ligand). The interest in DR5 recombinant protein research has surged due to its potential application in cancer therapy, particularly in overcoming the resistance of tumors to conventional treatments. Studies have shown that the activation of DR5 can trigger apoptotic pathways, making it a promising target for selective cancer therapies. Additionally, recombinant DR5 proteins can serve as tools for understanding the structural and functional mechanisms of DR5 signaling. This research extends to the development of DR5-based therapeutics, including DR5 agonistic antibodies and recombinant TRAIL, aimed at specifically inducing apoptosis in cancer cells while minimizing toxicity to normal tissues. As resistance mechanisms in tumors continue to challenge treatment efficacy, elucidating the role of DR5 and developing effective DR5-targeting strategies represent vital areas of ongoing investigation. The synthesis of DR5 as a recombinant protein allows for detailed studies of its interaction with ligands, downstream signaling pathways, and the exploration of its role in the tumor microenvironment. Furthermore, the potential of DR5 in combination therapies presents an exciting avenue for enhancing anti-cancer efficacy.
