Analytical Data
-
Gene name
USP6
- Application
-
Alternative Names
USP6;HRP1;TRE2;Ubiquitin carboxyl-terminal hydrolase 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35125
-
Expression Region
348-535aa
-
AA Sequence
KLTRKQGDLPPPAKREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAVREDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVRAISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLS
-
Molecular Weight
36.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
USP6 (Ubiquitin-Specific Protease 6) is a deubiquitinating enzyme that plays a crucial role in the regulation of various cellular processes, including cell proliferation, differentiation, and apoptosis. Its activity is significant in the context of cancer and other diseases, where it can modulate the stability and function of target proteins by removing ubiquitin chains, thereby influencing signaling pathways. Recent studies have identified USP6 as an oncogene associated with specific tumors, particularly those of mesenchymal origin, highlighting its potential as a therapeutic target. Given the importance of protein ubiquitination in cellular homeostasis and disease progression, the investigation of USP6's structure and function through recombinant protein technology has gained traction in the scientific community. By characterizing USP6 through expression and purification of recombinant forms, researchers aim to elucidate its enzymatic mechanisms, identify substrates, and understand its role in oncogenesis. Additionally, studying USP6 in a recombinant system provides insights into its interactions with other cellular partners and opens avenues for developing small-molecule inhibitors or monoclonal antibodies that can interfere with its activity. Such investigations may pave the way for novel therapeutic strategies in cancer treatment, making USP6 a promising candidate for future drug development efforts.











