Analytical Data
-
Gene name
IFNa13
- Application
-
Alternative Names
IFNa13；IFNA13；Interferon alpha-1/13
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01562
-
Expression Region
24-189aa
-
AA Sequence
M+CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQF QKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEA CVMQEERVGETPLMNVDSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEI MRSLSLSTNLQERLRRKE
-
Molecular Weight
20 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interferon alpha 13 (IFNa13) is a member of the type I interferon family, which plays a crucial role in the immune response against viral infections and tumors. Research on IFNa13 has gained interest due to its potential therapeutic applications, particularly in the treatment of viral infections like hepatitis C and certain cancers. Unlike other interferons, which have been extensively studied and utilized in clinical settings, IFNa13 exhibits unique structural and functional characteristics that may offer advantages such as enhanced antiviral activity and reduced side effects. Preliminary studies suggest that IFNa13 may modulate immune responses differently, potentially leading to improved efficacy in therapies. Furthermore, its role in cellular signaling pathways and interaction with specific receptors might provide insights into novel antiviral strategies. The recombinant production of IFNa13 has advanced our understanding of its properties and has opened new avenues for clinical research. Investigating this protein not only contributes to the broader knowledge of interferons but also has implications for developing innovative treatments for diseases where current therapies are limited or ineffective. As such, the study of IFNa13 represents a promising frontier in immunological research and therapeutic development.
