Analytical Data
-
Gene name
NOTCH1
- Application
-
Alternative Names
NOTCH1;TAN1;Neurogenic locus notch homolog Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P46531
-
Expression Region
2428-2555aa
-
AA Sequence
HLGRSFLSGEPSQADVQPLGPSSLAVHTILPQESPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
-
Molecular Weight
48.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NOTCH1 is a critical receptor in the Notch signaling pathway, which plays a pivotal role in various biological processes, including cell differentiation, proliferation, and apoptosis. Dysregulation of NOTCH1 signaling has been implicated in several diseases, particularly cancer, where mutations or aberrant activation can contribute to tumorigenesis. Researchers have developed recombinant NOTCH1 proteins to investigate their structure-function relationships and the molecular mechanisms underlying NOTCH signaling. These recombinant proteins are essential for exploring the interactions with ligands and other signaling partners, providing insights into the pathway's modulation. Furthermore, understanding the biochemical properties and functional dynamics of NOTCH1 can inform therapeutic strategies, as targeting this pathway holds potential for treating cancers and other disorders associated with NOTCH dysregulation. The generation of recombinant NOTCH1 proteins facilitates high-throughput screenings and functional assays, paving the way for novel discoveries in both basic and applied biomedical research.











