Analytical Data
-
Gene name
KLRK1
- Application
-
Alternative Names
KLRK1;D12S2489E;NKG2D;NKG2-D type II integral membrane Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26718
-
Expression Region
1-216aa
-
AA Sequence
MGWIRGRRSRHSWEMSEFHNYNLDLKKSDFSTRWQKQRCPVVKSKCRENASPFFFCCFIAVAMGIRFIIMVTIWSAVFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNTYICMQRTV
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLRK1, also known as NKG2D, is a type II transmembrane glycoprotein that belongs to the natural killer cell receptor family. It is primarily expressed on the surface of natural killer (NK) cells and some T cells, playing a critical role in immune responses against tumors and virally infected cells. The interest in KLRK1 has surged due to its significant involvement in immune regulation and potential as a therapeutic target in cancer immunotherapy. KLRK1 recognizes stress-induced ligands, such as MICA and MICB, which are upregulated in the presence of malignancies, thus facilitating the activation of cytotoxic T cells and NK cell-mediated lysis of target cells. Recent studies have focused on characterizing the structure and function of KLRK1, understanding its interactions with ligands, and exploring its signaling pathways. Moreover, recombinant KLRK1 proteins have been developed to study its biological functions in detail and assess its potential for therapeutic applications. These recombinant proteins can serve as tools for vaccine development, adoptive cell therapy, and combination therapies aimed at enhancing immune responses against cancers. Investigating KLRK1’s role may provide insights into innovative strategies for harnessing the immune system in the fight against cancer and other diseases.
