Analytical Data
-
Gene name
KLRC3
- Application
-
Alternative Names
KLRC3;NKG2E;NKG2-E type II integral membrane Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q07444
-
Expression Region
94-240aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMIPFLEQNNSSPNTRTQKARPCGHCPE EWITYSNSCYYIGKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASIL PSSWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQ CGSSRIIRRGFIMLTRLVLNS
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLRC3, also known as NKG2C, is a member of the natural killer (NK) cell receptor family, primarily involved in the immune response against cancerous and infected cells. Research into KLRC3 recombinant proteins has gained considerable attention due to their potential therapeutic applications in immunotherapy. The functional diversity of KLRC3, particularly its ability to regulate NK cell activation and cytotoxicity, makes it a crucial target for enhancing anti-tumor immunity. Studies have shown that KLRC3 interacts with a range of ligands, both in healthy and pathological conditions, influencing immune cell signaling pathways. Moreover, variations in KLRC3 expression levels have been associated with different cancer types and outcomes, prompting investigations into its role as a biomarker for cancer prognosis and as a target for novel therapeutic strategies. Recombinant KLRC3 proteins can be engineered to assess their functional properties, improve understanding of their interaction with ligands, and ultimately aid in the development of NK cell-based therapies. As researchers explore the intricacies of KLRC3’s mechanisms in immune modulation, the insights gained could lead to enhanced cancer treatments and improved patient outcomes. The growing interest in KLRC3 underscores its significance in immunology and its promising potential in clinical applications.
