Analytical Data
-
Gene name
flgM
- Application
-
Alternative Names
flgM;Negative regulator of flagellin synthesis
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0AEM4
-
Expression Region
1-97aa
-
AA Sequence
MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTSTSVTLSDAQAKLMQPGSSDINLERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN
-
Molecular Weight
17.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of the flgM recombinant protein is rooted in the understanding of bacterial flagellar assembly and regulation. FlgM is a key anti-sigma factor in bacteria, particularly in Salmonella and Escherichia coli, where it plays a crucial role in controlling the expression of flagellar genes. By binding to the sigma factor σ28, FlgM prevents the transcription of downstream flagellar operons in the absence of flagellar basal body assembly. This regulatory mechanism ensures that flagella are produced only when the bacterial cell is capable of assembling them, thus optimizing energy expenditure and preventing the synthesis of unnecessary components. Research on flgM has implications for understanding bacterial motility, pathogenesis, and biofilm formation. Furthermore, the characterization of flgM as a recombinant protein provides insights into its structure and function, paving the way for novel antimicrobial strategies. Given its regulatory role, flgM presents a potential target for disrupting bacterial movement and colonization. As such, exploring the properties of flgM at the molecular level can offer valuable information for developing new therapeutic approaches against bacterial infections, particularly in an era marked by rising antibiotic resistance. The investigation of flgM’s interactions, regulation, and overall significance in bacterial physiology continues to be an important avenue of research in microbiology and biotechnology.











