Cat: PA2000-4547

Recombinant Human flgM Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    flgM

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    flgM;Negative regulator of flagellin synthesis

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0AEM4

  • Expression Region

    1-97aa

  • AA Sequence

    MSIDRTSPLKPVSTVQPRETTDAPVTNSRAAKTTASTSTSVTLSDAQAKLMQPGSSDINLERVEALKLAIRNGELKMDTGKIADALINEAQQDLQSN

  • Molecular Weight

    17.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The study of the flgM recombinant protein is rooted in the understanding of bacterial flagellar assembly and regulation. FlgM is a key anti-sigma factor in bacteria, particularly in Salmonella and Escherichia coli, where it plays a crucial role in controlling the expression of flagellar genes. By binding to the sigma factor σ28, FlgM prevents the transcription of downstream flagellar operons in the absence of flagellar basal body assembly. This regulatory mechanism ensures that flagella are produced only when the bacterial cell is capable of assembling them, thus optimizing energy expenditure and preventing the synthesis of unnecessary components. Research on flgM has implications for understanding bacterial motility, pathogenesis, and biofilm formation. Furthermore, the characterization of flgM as a recombinant protein provides insights into its structure and function, paving the way for novel antimicrobial strategies. Given its regulatory role, flgM presents a potential target for disrupting bacterial movement and colonization. As such, exploring the properties of flgM at the molecular level can offer valuable information for developing new therapeutic approaches against bacterial infections, particularly in an era marked by rising antibiotic resistance. The investigation of flgM’s interactions, regulation, and overall significance in bacterial physiology continues to be an important avenue of research in microbiology and biotechnology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US