Cat: IPD-X12466

Recombinant Mouse Ephrin-B1/EFNB1 Protein(HEK293), C-hFc;C-6*His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Ephrin-B1/EFNB1

  • 简介

    Ephrin-B1/EFNB1 proteins are cell surface ligands of Eph receptors that critically regulate migration, repulsion, and adhesion during neuronal, vascular, and epithelial development. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc-His) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc, C-6*His labeled tag.

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Biological Activity

    1. Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 27.43 ng/mL, corresponding to a specific activity is 3.65×104 U/mg. 2. Measured by its binding ability in a functional ELISA. Immobilized mouse EphB3 at 2 µg/mL (100 µL/well) can bind biotinylated mouse Ephrin-B1 Protein. The ED50 for this effect is 10.01 ng/mL. Measured in a cell proliferation assay using HUVEC cells. The ED50 for this effect is 27.43 ng/mL, corresponding to a specific activity is 3.65×104 U/mg.

  • Alternative Names

    rMuEphrin-B1/EFNB1, Fc-His; Ephrin-B1; EFL-3; ELK ligand; ELK-L; EPH-related receptor tyrosine kinase ligand 2; LERK-2; EFNB1; EFL3; EPLG2; LERK2

  • Species

    Mouse

  • Source

    HEK293

  • Tag

    C-hFc;C-6*His

  • Purity

    Greater than 95% as determined by reducing SDS-PAGE.

  • Uniprot

    P52795

  • Expression Region

    K30-S229

  • AA Sequence

    KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS

  • Protein Length

    Partial

  • Molecular Weight

    58-80 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Ephrin-B1, encoded by the EFNB1 gene, is a member of the ephrin family, which plays a critical role in various biological processes, including neuronal development, angiogenesis, and cell adhesion. Research on Ephrin-B1 has gained momentum due to its involvement in cell signaling pathways mediated by Eph receptors, particularly in the context of developmental biology and cancer. The Ephrin-B1/Eph receptor interaction is crucial for bidirectional signaling, influencing cellular responses and tissue organization. Aberrant expression or mutations in EFNB1 have been linked to several pathological conditions, including tumors and neurological disorders. The study of recombinant Ephrin-B1 proteins allows for detailed exploration of their functional roles and mechanisms. By producing these proteins in a laboratory setting, researchers aim to investigate how Ephrin-B1 mediates cellular communication and promotes various biological responses. This understanding could uncover potential therapeutic targets for diseases where Ephrin-B1 signaling is disrupted, ultimately contributing to advances in treatment strategies for related health issues. The development and characterization of Ephrin-B1 recombinant proteins offer valuable insights into their structure-function relationships, potentially paving the way for novel interventions in regenerative medicine and oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US