Analytical Data
-
Gene name
Ephrin-B1/EFNB1
-
简介
Ephrin-B1/EFNB1 Protein, a transmembrane ligand, interacts with Eph receptors, facilitating bidirectional signaling. It binds EPHB1/ELK and EPHB2/3, inducing axon collapse and growth cone orientation. EFNB1 also interacts with GRIP1/2, TLE1, and enhances ZHX2's transcriptional repression activity. These interactions highlight EFNB1's role in diverse developmental processes. Ephrin-B1/EFNB1 Protein, Human (HEK293, His) is the recombinant human-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-6*His labeled tag.
- Application
-
Alternative Names
rHuEphrin-B1/EFNB1, His; Ephrin-B1; EFL-3; ELK ligand; EPH-related receptor tyrosine kinase ligand 2; LERK-2
-
Species
Human
-
Source
HEK293
-
Tag
C-6*His
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P98172
-
Expression Region
L28-G232
-
AA Sequence
LAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDG
-
Protein Length
Partial
-
Molecular Weight
28-34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ephrin-B1, encoded by the EFNB1 gene, is a member of the ephrin family, which plays a critical role in various biological processes, including neuronal development, angiogenesis, and cell adhesion. Research on Ephrin-B1 has gained momentum due to its involvement in cell signaling pathways mediated by Eph receptors, particularly in the context of developmental biology and cancer. The Ephrin-B1/Eph receptor interaction is crucial for bidirectional signaling, influencing cellular responses and tissue organization. Aberrant expression or mutations in EFNB1 have been linked to several pathological conditions, including tumors and neurological disorders. The study of recombinant Ephrin-B1 proteins allows for detailed exploration of their functional roles and mechanisms. By producing these proteins in a laboratory setting, researchers aim to investigate how Ephrin-B1 mediates cellular communication and promotes various biological responses. This understanding could uncover potential therapeutic targets for diseases where Ephrin-B1 signaling is disrupted, ultimately contributing to advances in treatment strategies for related health issues. The development and characterization of Ephrin-B1 recombinant proteins offer valuable insights into their structure-function relationships, potentially paving the way for novel interventions in regenerative medicine and oncology.
