Analytical Data
-
Gene name
Ephrin-B1/EFNB1
-
简介
Ephrin-B1 (EFNB1) protein binds to Eph family receptors, enabling signaling between receptor-expressing cells and cells with EFNB1. It is crucial for neuronal axon growth and expressed in various tissues like the adult lung and colon, highlighting its widespread presence and importance in mediating cellular interactions. Ephrin-B1/EFNB1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Ephrin-B1/EFNB1 protein, expressed by HEK293 , with C-hFc labeled tag.
- Application
-
Biological Activity
Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 7.89 ng/mL, corresponding to a specific activity is 1.267×105 U/mg. Measured in a cell proliferation assay using HUVEC cells. The ED50 this effect is 7.89 ng/mL, corresponding to a specific activity is 1.267×105 U/mg.
-
Alternative Names
Ephrin-B1; EFL-3; ELK-L; LERK-2; Ephrin-B1 CTF; EFNB1; EFL3; EPLG2; LERK2
-
Species
Mouse
-
Source
HEK293
-
Tag
C-hFc
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
NP_034240.1
-
Expression Region
K30-S229
-
AA Sequence
KNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPHQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQEEKSGPGAGGGGSGDS
-
Protein Length
Partial
-
Molecular Weight
55-75 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ephrin-B1, encoded by the EFNB1 gene, is a member of the ephrin family, which plays a critical role in various biological processes, including neuronal development, angiogenesis, and cell adhesion. Research on Ephrin-B1 has gained momentum due to its involvement in cell signaling pathways mediated by Eph receptors, particularly in the context of developmental biology and cancer. The Ephrin-B1/Eph receptor interaction is crucial for bidirectional signaling, influencing cellular responses and tissue organization. Aberrant expression or mutations in EFNB1 have been linked to several pathological conditions, including tumors and neurological disorders. The study of recombinant Ephrin-B1 proteins allows for detailed exploration of their functional roles and mechanisms. By producing these proteins in a laboratory setting, researchers aim to investigate how Ephrin-B1 mediates cellular communication and promotes various biological responses. This understanding could uncover potential therapeutic targets for diseases where Ephrin-B1 signaling is disrupted, ultimately contributing to advances in treatment strategies for related health issues. The development and characterization of Ephrin-B1 recombinant proteins offer valuable insights into their structure-function relationships, potentially paving the way for novel interventions in regenerative medicine and oncology.
