Cat: PA1000-1726

Recombinant Human KLF12 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KLF12

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KLF12;AP2REP;Krueppel-like factor 12

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9Y4X4

  • Expression Region

    1-402aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMNIHMKRKTIKNINTFENRMLMLDGMP AVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQT QTEPVDLSINKARTSPTAVSSSPVSMTASASSPSSTSTSSSSSSRLASSP TVITSVSSASSSSTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQS NKLSHVHRIPVVVQSVPVVYTAVRSPGNVNNTIVVPLLEDGRGHGKAQMD PRGLSPRQSKSDSDDDDLPNVTLDSVNETGSTALSIARAVQEVHPSPVSR VRGNRMNNQKFPCSISPFSIESTRRQRRSESPDSRKRRIHRCDFEGCNKV YTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHYRKHTGVKPF KCADCDRSFSRSDHLALHRRRHMLV

  • Molecular Weight

    47 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KLF12, a member of the Kruppel-like factor (KLF) family of transcription factors, plays a critical role in various biological processes, including cell differentiation, proliferation, and apoptosis. Its expression is particularly prominent in developing tissues and is implicated in several physiological and pathological conditions. Research has demonstrated that KLF12 influences gene expression by binding to specific DNA sequences, thereby regulating pathways involved in tissue development and responses to environmental signals. The dysregulation of KLF12 has been associated with various diseases, including cancer, where it may act as a tumor suppressor or, conversely, as an oncogene depending on the cellular context. The development of recombinant KLF12 protein has allowed researchers to explore its functional mechanisms in detail, providing insights into its structural characteristics, interaction with other proteins, and effects on gene regulation. This recombinant protein serves as a valuable tool for studying the signaling pathways involving KLF12 and evaluating its potential as a therapeutic target. By understanding KLF12's roles at the molecular level, researchers aim to uncover its contribution to health and disease, paving the way for novel treatments based on modulation of its activity.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US