Analytical Data
-
Gene name
YTHDF2
- Application
-
Alternative Names
YTHDF2；HGRG8；YTH domain-containing family Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5A9
-
Expression Region
2-579aa
-
AA Sequence
SASSLLEQRPKGQGNKVQNGSVHQKDGLNDDDFEPYLSPQARPNNAYTAMSDSYLPSYYSPSIGFSYSLGEAAWSTGGDTAMPYLTSYGQLSNGEPHFLPDAMFGQPGALGSTPFLGQHGFNFFPSGIDFSAWGNNSSQGQSTQSSGYSSNYAYAPSSLGGAMIDGQSAFANETLNKAPGMNTIDQGMAALKLGSTEVASNVPKVVGSAVGSGSITSNIVASNSLPPATIAPPKPASWADIASKPAKQQPKLKTKNGIAGSSLPPPPIKHNMDIGTWDNKGPVAKAPSQALVQNIGQPTQGSPQPVGQQANNSPPVAQASVGQQTQPLPPPPPQPAQLSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQEEEESVKKERQGRGK
-
Molecular Weight
68.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
YTHDF2 is a member of the YTH domain family of proteins, which are known to recognize and bind to N6-methyladenosine (m6A) modifications on RNA molecules. This modification is the most prevalent internal mRNA modification and plays a crucial role in regulating various aspects of RNA metabolism, including RNA stability, splicing, transport, and translation. Research has shown that YTHDF2 is primarily involved in the degradation of m6A-containing mRNAs, thereby influencing gene expression and cellular processes. The dysregulation of YTHDF2 has been linked to several diseases, including cancers, emphasizing the importance of understanding its functional mechanisms. Furthermore, studying YTHDF2 as a recombinant protein provides valuable insights into its structural properties and binding affinities, facilitating the exploration of novel therapeutic strategies targeting m6A pathways. The generation and characterization of recombinant YTHDF2 protein allow researchers to conduct in vitro assays to investigate its interaction with RNA and other regulatory proteins, shedding light on its role in post-transcriptional gene regulation. Overall, the study of YTHDF2 and its recombinant protein form is pivotal in elucidating the complex regulatory networks of m6A modifications and their implications in health and disease.
