Analytical Data
-
Gene name
KHK
- Application
-
Alternative Names
KHK;Ketohexokinase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P50053
-
Expression Region
1-298aa
-
AA Sequence
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
-
Molecular Weight
59.7kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KHK (Ketohexokinase) is an enzyme that plays a crucial role in the metabolism of fructose, primarily catalyzing its phosphorylation to fructose-1-phosphate. Research on KHK has gained significant attention due to its implications in various metabolic disorders, including obesity, diabetes, and non-alcoholic fatty liver disease. The increasing prevalence of fructose in Western diets, primarily from sugar-sweetened beverages and processed foods, has raised concerns regarding its impact on human health. Abnormal KHK activity has been linked to excessive fructose consumption, contributing to sugar-induced metabolic syndrome. Moreover, KHK exists in two isoforms, KHK-C and KHK-A, with differing regulatory properties and tissue distribution, making it a potential target for therapeutic interventions. Analyzing KHK recombinant proteins offers insights into its structure-function relationships, enzymatic pathways, and regulatory mechanisms, paving the way for the development of selective inhibitors that could mitigate the adverse health effects associated with high fructose intake. Currently, structural studies and kinetic analyses of KHK recombinant proteins are crucial for understanding its role in fructose metabolism and for designing novel strategies to combat metabolic diseases associated with dietary sugars.











