Analytical Data
-
Gene name
KCTD5
- Application
-
Alternative Names
KCTD5;BTB/POZ domain-containing Protein KCTD5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NXV2
-
Expression Region
1-234aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAENHCELLSPARGGIGAGLGGGLCRR CSAGLGALAQRPGSVSKWVRLNVGGTYFLTTRQTLCRDPKSFLYRLCQAD PDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAEEGVLEEAE FYNITSLIKLVKDKIRERDSKTSQVPVKHVYRVLQCQEEELTQMVSTMSD GWKFEQLVSIGSSYNYGNEDQAEFLCVVSKELHNTPYGTASEPSEKAKIL QERGSRM
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCTD5, or potassium channel tetramerization domain containing 5, is a member of the KCTD protein family, which has emerged as an important player in various biological processes and disease mechanisms. Recent studies have indicated that KCTD5 is involved in the regulation of neuronal signaling and synaptic function, suggesting its potential role in neurodevelopmental and neurodegenerative disorders. Its interactions with various signaling pathways, including G protein-coupled receptors and ion channels, highlight its significance in maintaining cellular homeostasis. Furthermore, KCTD5 has been implicated in cancer biology, where it may influence cell proliferation and apoptosis. Given these diverse roles, researchers are increasingly focused on the characterization and expression of recombinant KCTD5 protein to elucidate its functional mechanisms. Producing recombinant KCTD5 provides a valuable tool for investigating its structure-function relationships, post-translational modifications, and interactions with other molecular partners. This research is essential for understanding the physiological and pathological implications of KCTD5, potentially paving the way for novel therapeutic strategies targeting this protein in neurological and oncological disorders.
