Analytical Data
-
Gene name
CORIN
- Application
-
Alternative Names
CORIN；CRN；TMPRSS10；Atrial natriuretic peptide-converting enzyme
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5Q5
-
Expression Region
1-110aa
-
AA Sequence
MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS
-
Molecular Weight
16.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CORIN is a critical protease that plays a significant role in the cleavage of atrial natriuretic peptide (ANP) precursors, which are crucial for regulating blood pressure and fluid balance. Dysregulation of CORIN has been linked to various cardiovascular diseases, including hypertension and heart failure. Research has focused on understanding the structure, function, and regulatory mechanisms of CORIN to exploit its potential as a therapeutic target. Studies have shown that genetic variations in the CORIN gene can influence its activity and are associated with the risk of cardiovascular disorders. Moreover, the development of CORIN-related diagnostic and therapeutic modalities is an emerging field, particularly in the context of precision medicine. The recombination of this protein is essential for exploring its mechanistic roles and developing potential interventions. Thus, the investigation of CORIN and its functionalities in pathophysiological contexts continues to be a significant area of research within cardiovascular biology.
