Analytical Data
-
Gene name
KCTD4
- Application
-
Alternative Names
KCTD4;BTB/POZ domain-containing Protein KCTD4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8WVF5
-
Expression Region
1-259aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMERKINRREKEKEYEGKHNSLEDTDQG KNCKSTLMTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHY FIDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVK SRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDFISKIKSRIVLVSK SRLDGFPEEFSISSNIIQFKYFIKSENGTRLVLKEDNTFVCTLETLKFEA IMMALKCGFRLLTSLDCSKGSIVHSDALHFIK
-
Molecular Weight
32 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCTD4, a member of the potassium channel tetramerization domain-containing (KCTD) family, has garnered attention in recent years due to its potential roles in a variety of biological processes and pathological conditions. Initially identified as a protein involved in the modulation of potassium channels, KCTD4 has since been implicated in the regulation of cellular signaling pathways, including those related to neurodevelopment and synaptic plasticity. Recent studies have suggested that KCTD4 may play a critical role in the pathogenesis of several diseases, including neurodegenerative disorders and certain types of cancers, where its expression levels and functional alterations can influence cell proliferation and survival. Additionally, the protein's interactions with other cellular molecules indicate its involvement in complex regulatory networks. The recombinant production of KCTD4 protein is vital for elucidating its structural and functional characteristics, allowing researchers to investigate its role in health and disease at a molecular level. Techniques such as expression in host cells, purification, and characterization are essential for generating sufficient quantities of functional KCTD4 protein for experimental analysis. Understanding KCTD4's functions and interactions will not only enhance our knowledge of its biological significance but may also pave the way for potential therapeutic targets in diseases associated with its dysregulation.
