Analytical Data
-
Gene name
IYD
- Application
-
Alternative Names
IYD;C6orf71;DEHAL1;Iodotyrosine deiodinase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PHW0-3
-
Expression Region
24-214aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSDRSMEKKKGEPRTRAEARPWVDEDLKD SSDLHQAEEDADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKR RSVRFISNEQVPMEVIDNVIRTAGTAPSGAHTEPWTFVVVKDPDVKHKIR KIIEEEEEINYMKRMGHRWVTDLKKLRTNWIKEYLDTAPILILIFKQVHG FAANGKKKVH YYNE
-
Molecular Weight
25 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IYD (iodotyrosine deiodinase) is an enzyme that plays a crucial role in the metabolism of thyroid hormones. It catalyzes the deiodination of iodotyrosines, which are important precursors in the synthesis of thyroid hormones, including thyroxine (T4) and triiodothyronine (T3). Research on IYD has gained significance due to its potential implications in thyroid-related disorders, including hypothyroidism and hyperthyroidism. Dysregulation of thyroid hormone levels can lead to a myriad of health issues, from metabolic disorders to developmental impairments. Furthermore, understanding the structure and function of IYD at the molecular level can provide insights into the enzymatic mechanisms that regulate thyroid hormone homeostasis. The recombinant production of IYD protein has become a vital tool in this research, enabling researchers to study its activity, interactions, and regulation in detail. By employing techniques such as molecular cloning and expression in suitable host systems, scientists can obtain large quantities of IYD for various experimental applications. Additionally, the characterization of IYD through techniques such as crystallography and spectroscopy can illuminate its functional properties and inform therapeutic strategies for thyroid disorders. Overall, the study of recombinant IYD protein is essential for advancing our understanding of thyroid hormone metabolism and developing novel approaches to treat thyroid abnormalities.
