Analytical Data
-
Gene name
IL10
- Application
-
Alternative Names
IL10;Interleukin-10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22301
-
Expression Region
26-178aa
-
AA Sequence
SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFK GYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRR CHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMK IRN
-
Molecular Weight
18 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-10 (IL-10) is a crucial anti-inflammatory cytokine that plays a significant role in regulating immune responses. It is primarily produced by various immune cells, including T cells, B cells, and macrophages, and is known to inhibit the synthesis of pro-inflammatory cytokines such as IL-6 and tumor necrosis factor-alpha (TNF-α). The therapeutic potential of recombinant IL-10 protein has gained considerable attention in recent years, particularly in the context of autoimmune diseases, inflammatory disorders, and infections. Research has demonstrated that administering IL-10 can modulate excessive inflammatory responses, promote tissue repair, and enhance immune tolerance. In conditions like rheumatoid arthritis, inflammatory bowel disease, and certain viral infections, IL-10 therapy has shown promise in preclinical and clinical studies. Additionally, due to its immunomodulatory properties, IL-10 is being investigated as a potential treatment strategy for cancer, aiming to counteract the immunosuppressive tumor microenvironment. As the understanding of IL-10 signaling pathways and mechanisms of action continues to grow, the development of recombinant IL-10 and its derivatives offers exciting opportunities for novel therapeutic interventions that can improve patient outcomes in a variety of diseases characterized by dysregulated inflammatory processes.
