Cat: PA1000-1670

Recombinant Human IL10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL10;Interleukin-10

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P22301

  • Expression Region

    26-178aa

  • AA Sequence

    SENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFK GYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRR CHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMK IRN

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-10 (IL-10) is a crucial anti-inflammatory cytokine that plays a significant role in regulating immune responses. It is primarily produced by various immune cells, including T cells, B cells, and macrophages, and is known to inhibit the synthesis of pro-inflammatory cytokines such as IL-6 and tumor necrosis factor-alpha (TNF-α). The therapeutic potential of recombinant IL-10 protein has gained considerable attention in recent years, particularly in the context of autoimmune diseases, inflammatory disorders, and infections. Research has demonstrated that administering IL-10 can modulate excessive inflammatory responses, promote tissue repair, and enhance immune tolerance. In conditions like rheumatoid arthritis, inflammatory bowel disease, and certain viral infections, IL-10 therapy has shown promise in preclinical and clinical studies. Additionally, due to its immunomodulatory properties, IL-10 is being investigated as a potential treatment strategy for cancer, aiming to counteract the immunosuppressive tumor microenvironment. As the understanding of IL-10 signaling pathways and mechanisms of action continues to grow, the development of recombinant IL-10 and its derivatives offers exciting opportunities for novel therapeutic interventions that can improve patient outcomes in a variety of diseases characterized by dysregulated inflammatory processes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US