Analytical Data
-
Gene name
IFNB
- Application
-
Alternative Names
IFNB1;IFB;IFNB;Interferon beta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01574
-
Expression Region
22-187aa
-
AA Sequence
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
-
Molecular Weight
47.0kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interferon beta (IFN-β) is a cytokine with significant therapeutic potential, particularly in the treatment of multiple sclerosis (MS) and certain viral infections. Its role in modulating immune responses has led to extensive research into its mechanism of action and clinical applications. Early studies identified IFN-β as a crucial player in the regulation of inflammatory processes, enhancing the body's defense against pathogens. The advent of recombinant DNA technology in the 1980s facilitated the production of IFN-β, allowing for a more consistent and efficient source compared to natural extraction from lymphocytes. This development has spurred the investigation of various recombinant forms of IFN-β, leading to the approval of several products for clinical use, such as Avonex and Rebif. Ongoing research focuses on understanding the pharmacokinetics, optimal dosing strategies, and potential side effects of IFN-β therapy. Additionally, scientists are exploring combination therapies, wherein IFN-β is used alongside other immunomodulatory agents to enhance therapeutic outcomes in MS and related conditions. The continuous evolution of IFN-β research reflects its enduring significance in both basic and translational medicine, aiming to improve patient outcomes and expand its utility in broader therapeutic contexts.
