Analytical Data
-
Gene name
KCNC3
- Application
-
Alternative Names
KCNC3; Potassium voltage-gated channel subfamily C member 3; KSHIIID; Voltage-gated potassium channel subunit Kv3.3
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q14003
-
Expression Region
671-757aa
-
AA Sequence
ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
-
Molecular Weight
35.31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNC3, a member of the potassium channel family, encodes for the voltage-gated K channels and plays a crucial role in the regulation of membrane potential and neuronal excitability. Mutations in the KCNC3 gene have been linked to a rare neurological disorder known as Spinocerebellar Ataxia type 13 (SCA13), characterized by progressive ataxia and other motor coordination issues. The study of KCNC3 recombinant protein is significant as it helps in elucidating the functional properties of the channel, including its ion selectivity, gating kinetics, and interaction with other cellular proteins. Understanding the structure and function of KCNC3 is essential for developing targeted therapies for SCA13 and other related disorders. Research involving recombinant KCNC3 protein can enhance our comprehension of potassium channelopathies and contribute to innovations in drug design and molecular therapies that aim to correct the dysfunctional signaling pathways resulting from KCNC3 mutations. As scientists continue to analyze the protein's behavior in various cellular contexts, it holds the promise of advancing our knowledge of not only KCNC3-related pathologies but also the broader implications of potassium channels in health and disease.
