Cat: PA2000-310DB

Recombinant Human TRPV1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TRPV1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TRPV1;VR1;Transient receptor potential cation channel subfamily V member 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8NER1

  • Expression Region

    21-124aa

  • AA Sequence

    CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGEL DSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFE AVAQ

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Transient Receptor Potential Vanilloid 1 (TRPV1) is a pivotal ion channel involved in nociception, the process by which sensory neurons respond to harmful stimuli, including heat and inflammatory pain. Discovered in the late 1990s, TRPV1 is activated by a variety of endogenous and exogenous ligands, such as capsaicin, the active component in chili peppers, and noxious heat. Research has revealed its critical role not only in pain perception but also in a range of physiological functions, such as thermoregulation and the modulation of inflammation. Given its significant involvement in pain pathways, TRPV1 has emerged as a promising target for the development of novel analgesics. The recombinant expression of TRPV1 protein in various systems, such as bacteria, yeast, or mammalian cells, allows for detailed structural and functional studies. These investigations seek to elucidate the channel’s activation mechanisms, ligand interactions, and pharmacological profiles. Furthermore, the structural insights gained from crystallography and cryo-electron microscopy of TRPV1 can be instrumental in designing selective small-molecule inhibitors that could effectively manage chronic pain without the side effects associated with conventional analgesics. Thus, the ongoing research into TRPV1 recombinant proteins not only enhances our understanding of nociceptive signaling but also opens avenues for therapeutic innovation in pain management and related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US