Analytical Data
-
Gene name
TRPV1
- Application
-
Alternative Names
TRPV1;VR1;Transient receptor potential cation channel subfamily V member 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NER1
-
Expression Region
21-124aa
-
AA Sequence
CPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGEL DSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFE AVAQ
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Transient Receptor Potential Vanilloid 1 (TRPV1) is a pivotal ion channel involved in nociception, the process by which sensory neurons respond to harmful stimuli, including heat and inflammatory pain. Discovered in the late 1990s, TRPV1 is activated by a variety of endogenous and exogenous ligands, such as capsaicin, the active component in chili peppers, and noxious heat. Research has revealed its critical role not only in pain perception but also in a range of physiological functions, such as thermoregulation and the modulation of inflammation. Given its significant involvement in pain pathways, TRPV1 has emerged as a promising target for the development of novel analgesics. The recombinant expression of TRPV1 protein in various systems, such as bacteria, yeast, or mammalian cells, allows for detailed structural and functional studies. These investigations seek to elucidate the channel’s activation mechanisms, ligand interactions, and pharmacological profiles. Furthermore, the structural insights gained from crystallography and cryo-electron microscopy of TRPV1 can be instrumental in designing selective small-molecule inhibitors that could effectively manage chronic pain without the side effects associated with conventional analgesics. Thus, the ongoing research into TRPV1 recombinant proteins not only enhances our understanding of nociceptive signaling but also opens avenues for therapeutic innovation in pain management and related disorders.











