Analytical Data
-
Gene name
JARID1A
- Application
-
Alternative Names
Histone demethylase JARID1A; JARID1A; Jumonji/ARID domain containing protein 1A; Jumonji/ARID domain-containing protein 1A; Kdm5a; KDM5A_HUMAN; Lysine-specific demethylase 5A; RBBP-2; RBBP2; RBP2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P29375
-
Expression Region
437-603aa
-
AA Sequence
EYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVNHYR
-
Molecular Weight
21.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
JARID1A, a member of the Jumonji C domain-containing family of proteins, has garnered significant attention in epigenetics due to its role as a histone demethylase. This protein specifically targets histone H3 lysine 4 (H3K4), a modification associated with transcriptional activation, thereby playing a crucial role in regulating gene expression and maintaining cellular identity. Aberrant expression or mutations in JARID1A are linked to various cancers and developmental disorders, highlighting its potential as a therapeutic target. Research on recombinant JARID1A proteins involves understanding their enzymatic activity, structural properties, and interactions with both histone substrates and other regulatory proteins. Such studies provide insights into the molecular mechanisms underpinning JARID1A's function and its contributions to epigenetic regulation. The development of recombinant JARID1A proteins facilitates the investigation of its demethylation activity in vitro, enabling researchers to explore its role in chromatin remodeling and transcriptional regulation in different biological contexts. This research is pivotal for elucidating how alterations in JARID1A function can lead to dysregulated gene expression and contribute to disease progression, paving the way for potential therapeutic interventions targeting JARID1A-mediated pathways in cancer and other disorders.
