Analytical Data
-
Gene name
IL-1β
- Application
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P01584
-
Expression Region
117-269aa
-
AA Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
-
Molecular Weight
33.4kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-1 beta (IL-1β) is a pro-inflammatory cytokine that plays a crucial role in the immune response, inflammation, and various pathological conditions such as autoimmune diseases, chronic inflammatory disorders, and cancer. As a member of the interleukin-1 family, IL-1β is primarily produced by activated macrophages and is involved in the regulation of immune cell activation, proliferation, and differentiation. Its dysregulation is linked to numerous diseases, making it a significant target for therapeutic interventions. Recombinant IL-1β proteins have been developed for research and clinical applications, enabling scientists to study its biological functions, signaling pathways, and interactions with other cytokines. The production of IL-1β as a recombinant protein allows for the investigation of its role in various inflammatory processes and provides a platform for drug discovery aimed at modulating IL-1β activity. Moreover, IL-1β has emerged as a promising target for therapeutic agents designed to treat conditions such as rheumatoid arthritis, type 2 diabetes, and systemic inflammatory response syndrome. The ongoing research into IL-1β, its receptors, and its downstream signaling mechanisms continues to illuminate its importance in health and disease, driving the development of novel therapeutic approaches. Understanding the complex role of IL-1β in inflammation and its functional mechanisms remains a critical focus in immunology and therapeutic development. With advancements in biotechnology, the study of recombinant IL-1β protein has become essential for both basic research and clinical advancements, underscoring the need for continued exploration of this vital cytokine in the context of various diseases.
