Cat: PA1000-1580

Recombinant Human IGFLR1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IGFLR1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IGFLR1;TMEM149;U2AF1L4;IGF-like family receptor 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H665

  • Expression Region

    23-163aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSSQYCGRLEYWNPDNKCCSSCLQRFGPP PCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTP TPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRT PEPVPQQAWPNFLP

  • Molecular Weight

    18 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IGFLR1, or Insulin-like Growth Factor Like Receptor 1, is a member of the insulin receptor family that plays a crucial role in cellular growth, differentiation, and survival. The receptor’s structure and function have garnered attention due to its involvement in various physiological processes and its potential implications in diseases such as cancer and metabolic disorders. Recent studies suggest that IGFLR1 may modulate insulin-like growth factor (IGF) signaling pathways, which are important in regulating cell proliferation and apoptosis. This has prompted research into the reconstitution and characterization of IGFLR1 as a recombinant protein to better understand its biological functions, signaling mechanisms, and interactions with ligands. The production of IGFLR1 as a recombinant protein allows for in-depth investigations into its role in health and disease, enabling researchers to explore its potential as a therapeutic target. The study of IGFLR1 not only expands our knowledge of insulin receptor family members but also opens avenues for developing novel strategies in treating IGF-related disorders. Understanding the molecular mechanisms of IGFLR1 through recombinant protein studies could lead to innovative approaches in regenerative medicine and cancer therapeutics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US