Analytical Data
-
Gene name
ITGB1BP2
- Application
-
Alternative Names
ITGB1BP2; MSTP015; Integrin beta-1-binding protein 2; Melusin
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UKP3
-
Expression Region
1-347aa
-
AA Sequence
MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDFSEFLNIKGCTMGPHCAEKLPEAPQPEGPATSSSLQEQKPLNVIPKSAETLRRERPKSELPLKLLPLNISQALEMALEQKELDQEPGAGLDSLIRTGSSCQNPGCDAVYQGPESDATPCTYHPGAPRFHEGMKSWSCCGIQTLDFGAFLAQPGCRVGRHDWGKQLPASCRHDWHQTDSLVVVTVYGQIPLPAFNWVKASQTELHVHIVFDGNRVFQAQMKLWGVINVEQSSVFLMPSRVEISLVKADPGSWAQLEHPDALAKKARAGVVLEMDEEESDDSDDDLSWTEEEEEEEAMGE
-
Molecular Weight
64.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ITGB1BP2, or Integrin beta-1 binding protein 2, is a crucial regulator in various cellular processes, including cell adhesion, migration, and proliferation. Its interaction with integrins, particularly the beta-1 subunit, implicates it in critical pathways associated with tissue development and repair. Research has demonstrated that ITGB1BP2 plays a significant role in cancer biology, notably influencing tumor progression and metastasis. This has sparked interest in elucidating its structure and function, particularly through the study of recombinant proteins. By expressing and purifying ITGB1BP2 as a recombinant protein, researchers aim to better understand its biological mechanisms and potential as a therapeutic target. Furthermore, studying its interactions with integrins and other binding partners can provide insights into its role in pathological conditions, including fibrosis and inflammatory diseases. Ultimately, characterizing ITGB1BP2 in a recombinant form facilitates the development of targeted interventions and contributes to the broader understanding of integrin-mediated signaling pathways.
