Analytical Data
-
Gene name
Ccl5
- Application
-
Alternative Names
Ccl5；D17S136E；SCYA5；C-C motif chemokine 5
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P13501
-
Expression Region
24-91aa
-
AA Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
-
Molecular Weight
14.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Ccl5, also known as RANTES (Regulated upon Activation, Normal T Expressed and Secreted), is a chemokine that plays a critical role in immune responses by recruiting various immune cells, including T cells, eosinophils, and basophils, to sites of inflammation. Its involvement in numerous physiological and pathological processes, such as viral infections, autoimmune diseases, and cancer progression, has made Ccl5 a significant target for biomedical research. Recombination technology allows for the production of Ccl5 recombinant protein, enabling researchers to study its structure, function, and interactions in detail. The production of this protein using techniques such as bacterial expression systems or mammalian cell lines offers insights into its potential therapeutic applications, including the development of Ccl5 inhibitors that could modulate inflammatory responses. Moreover, understanding the mechanisms by which Ccl5 influences cell migration and activation can lead to novel strategies for treating diseases characterized by excessive inflammation or immune dysregulation. Consequently, the research surrounding Ccl5 recombinant protein not only enhances our comprehension of immune cell dynamics but also paves the way for innovative therapeutic approaches in managing various diseases.
