Cat: PA2000-4379

Recombinant Human Ccl5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    Ccl5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    Ccl5;D17S136E;SCYA5;C-C motif chemokine 5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13501

  • Expression Region

    24-91aa

  • AA Sequence

    SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS

  • Molecular Weight

    14.8 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Ccl5, also known as RANTES (Regulated upon Activation, Normal T Expressed and Secreted), is a chemokine that plays a critical role in immune responses by recruiting various immune cells, including T cells, eosinophils, and basophils, to sites of inflammation. Its involvement in numerous physiological and pathological processes, such as viral infections, autoimmune diseases, and cancer progression, has made Ccl5 a significant target for biomedical research. Recombination technology allows for the production of Ccl5 recombinant protein, enabling researchers to study its structure, function, and interactions in detail. The production of this protein using techniques such as bacterial expression systems or mammalian cell lines offers insights into its potential therapeutic applications, including the development of Ccl5 inhibitors that could modulate inflammatory responses. Moreover, understanding the mechanisms by which Ccl5 influences cell migration and activation can lead to novel strategies for treating diseases characterized by excessive inflammation or immune dysregulation. Consequently, the research surrounding Ccl5 recombinant protein not only enhances our comprehension of immune cell dynamics but also paves the way for innovative therapeutic approaches in managing various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US