Cat: PA1000-1549

Recombinant Human IDH3G Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IDH3G

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IDH3G;Isocitrate dehydrogenase [NAD] subunit gamma. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P51553

  • Expression Region

    1-393aa

  • AA Sequence

    MALKVATVAGSAAKAVLGPALLCRPWEVLGAHEVPSRNIFSEQTIPPSAK YGGRHTVTMIPGDGIGPELMLHVKSVFRHACVPVDFEEVHVSSNADEEDI RNAIMAIRRNRVALKGNIETNHNLPPSHKSRNNILRTSLDLYANVIHCKS LPGVVTRHKDIDILIVRENTEGEYSSLEHESVAGVVESLKIITKAKSLRI AEYAFKLAQESGRKKVTAVHKANIMKLGDGLFLQCCREVAARYPQITFEN MIVDNTTMQLVSRPQQFDVMVMPNLYGNIVNNVCAGLVGGPGLVAGANYG HVYAVFETATRNTGKSIANKNIANPTATLLASCMMLDHLKLHSYAASIRK AVLASMDNENMHTPDIGGQGTTSEAIQDVIRHIRVINGRAVEA

  • Molecular Weight

    69 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IDH3G, or isocitrate dehydrogenase 3 gamma, is a mitochondrial enzyme involved in the citric acid cycle, playing a crucial role in cellular energy metabolism. Research on IDH3G has gained significance due to its implications in various metabolic disorders and age-related diseases. Mutations in IDH3G can lead to altered enzymatic activity, which may contribute to oxidative stress and mitochondrial dysfunction, factors associated with neurodegenerative diseases and cancer. Additionally, IDH3G has been implicated in regulating metabolic pathways that influence cellular responses to environmental stresses, such as hypoxia and nutrient deprivation. Understanding the structure and function of IDH3G, as well as the effects of its recombination, could provide insights into potential therapeutic strategies for diseases linked to metabolic dysregulation. Recent studies have focused on recombinant protein expression and purification of IDH3G to elucidate its enzymatic mechanisms and structure-function relationships. This research aims to provide a clearer understanding of IDH3G's role in cellular metabolism and its potential as a biomarker or therapeutic target in diseases characterized by mitochondrial impairment. Overall, IDH3G represents an important target for further investigation in metabolic biology, with the potential to inform new approaches to treatment and prevention of related conditions.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US