Analytical Data
-
Gene name
Cxcl11
- Application
-
Alternative Names
Cxcl11；ITAC；SCYB11；SCYB9B；C-X-C motif chemokine 11
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O14625
-
Expression Region
22-94aa
-
AA Sequence
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKG QRCLNPKSKQARLIIKKVERKNF
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CXCL11, also known as I-TAC (interferon-inducible T cell alpha chemoattractant), is a chemokine belonging to the CXC family that plays a crucial role in immune responses and inflammatory processes. It primarily attracts T cells, particularly Th1 cells, and has been implicated in various pathological conditions, including autoimmune diseases, cancer, and viral infections. Research on recombinant CXCL11 protein has gained significance due to its potential applications in therapeutic strategies, including enhancing anti-tumor immunity and modulating chronic inflammatory responses. Recombinant protein production allows for the study of its biological activities, interactions with receptors, and signaling pathways, which are essential for understanding its function in the immune system. Additionally, the development of CXCL11 as a therapeutic agent could provide novel approaches for immunotherapy, especially in malignancies where T cell recruitment is limited. Understanding the structure-function relationship of CXCL11 through recombinant technology can further elucidate its roles in health and disease, offering insights that could lead to innovative treatment modalities.
