Analytical Data
-
Gene name
ID1
- Application
-
Alternative Names
ID1;BHLHB24;ID;DNA-binding Protein inhibitor ID-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P41134
-
Expression Region
1-155aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMKVASGSTATAAAGPSCALKAGKTASG AGEVVRCLSEQSVAISRCAGGAGARLPALLDEQQVNVLLYDMNGCYSRLK ELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGGRGLPVRA PLSTLNGEISALTAEAACVPADDRILCR
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ID1, or Inhibitor of DNA Binding 1, is a member of the basic helix-loop-helix (bHLH) transcription factor family, playing a crucial role in regulating cell differentiation, proliferation, and survival. Originally identified for its function as an inhibitor of bHLH proteins, ID1 is implicated in various biological processes, including neovascularization and tumorigenesis. Research has shown that ID1 is often upregulated in numerous cancers, leading to its association with poor prognosis and aggressive tumor behavior. This overexpression is linked to the deregulation of key signaling pathways, including those mediated by growth factors and oncogenes. Moreover, ID1 has emerged as a potential biomarker for cancer diagnosis and prognosis due to its differential expression patterns in various malignancies. Given its significant role in maintaining the undifferentiated state of stem cells and its involvement in epithelial-to-mesenchymal transition (EMT), ID1 offers a promising target for therapeutic interventions. Recent studies are increasingly focusing on unraveling the mechanisms underlying ID1 regulation and function, with the aim of developing novel strategies to inhibit its activity as a means to combat ID1-positive cancers. These investigations highlight the importance of ID1 in both basic biological research and clinical applications, emphasizing the need for further exploration of its pathways and interactions within the cellular environment.
