Analytical Data
-
Gene name
CCL18
- Application
-
Alternative Names
CCL18;AMAC1;DCCK1;MIP4;C-C motif chemokine 18
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55774
-
Expression Region
21-89aa
-
AA Sequence
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQIC ADPNKKWVQKYISDLKLNA
-
Molecular Weight
8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CCL18, also known as pulmonary and activation-regulated chemokine (PARC), is a chemokine produced primarily by alveolar macrophages and is implicated in various biological processes, including immune response, inflammation, and tissue remodeling. Its role has been extensively studied in the context of pulmonary diseases such as asthma, fibrosis, and chronic obstructive pulmonary disease (COPD), where elevated levels of CCL18 have been associated with disease progression and severity. Given its potential as a biomarker for these conditions, CCL18 has garnered attention as a therapeutic target. The development of recombinant CCL18 protein has facilitated detailed investigations into its mechanistic functions, receptor interactions, and effects on various immune cell types. This research aims to elucidate the pathways influenced by CCL18, enhancing the understanding of its contribution to pathophysiological processes. Moreover, the recombinant protein serves as a valuable tool for screening potential inhibitors or modulators that could translate into novel treatment strategies. Overall, studies on CCL18 not only expand the knowledge of chemokine biology but also hold promise for innovative approaches to managing chronic inflammatory diseases.











