Analytical Data
-
Gene name
TLCD1
- Application
-
Alternative Names
TLCD1；TLC domain-containing Protein 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96CP7
-
Expression Region
36-247aa
-
AA Sequence
RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE
-
Molecular Weight
26.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TLCD1, or the Tetranectin-like protein 1, is a member of the tetranectin family, which plays a critical role in various biological processes, including cell adhesion, migration, and differentiation. Recent studies have indicated that TLCD1 may be involved in the regulation of extracellular matrix components, making it relevant to both normal physiological functions and pathological conditions, such as cancer progression and tissue remodeling. The research on TLCD1 recombinant proteins has gained momentum due to their potential applications in therapeutic interventions and biomarker development. By employing molecular cloning techniques and recombinant DNA technology, researchers have been able to produce TLCD1 in appropriate host systems, allowing for detailed structural and functional analyses. Investigating the properties of TLCD1 can illuminate its role in cell signaling pathways and its interactions with other extracellular matrix proteins. Furthermore, understanding the functional implications of TLCD1 can provide insights into diseases where the extracellular matrix plays a pivotal role. As studies continue to explore the biochemical pathways associated with TLCD1, the characterization of its recombinant proteins will be essential for elucidating their potential roles in health and disease, ultimately contributing to the development of novel therapeutic strategies and improving our understanding of extracellular matrix dynamics.
