Analytical Data
-
Gene name
N75Q
- Application
-
Alternative Names
N75Q;
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P31785
-
Expression Region
56-254aa
-
AA Sequence
PLPEVQCFVFNVEYMNCTWQSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNTSKEN
-
Molecular Weight
25.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
N75Q is a recombinant protein that has garnered considerable attention in the field of biomedical research due to its multifaceted roles in cellular processes. Initially identified in the context of cancer studies, this protein variant is known for its potential involvement in the regulation of cellular signaling pathways, which are crucial for cell growth, differentiation, and apoptosis. Research has indicated that mutations in proteins like N75Q can lead to altered interactions with other cellular components, potentially dysregulating important biochemical pathways. Consequently, scientists have focused on understanding the structure-function relationships of N75Q to unravel its mechanisms of action. Furthermore, its implications extend beyond cancer research, with studies exploring its role in neurodegenerative diseases and other conditions where protein misfolding is a central feature. The ability to produce N75Q as a recombinant protein facilitates in vitro studies, allowing researchers to investigate its biophysical properties, interactions with ligands, and response to therapeutic agents. Overall, the investigation of N75Q presents a promising avenue for elucidating the complexities of protein behavior in health and disease, aiming to identify novel therapeutic targets and strategies.











