Analytical Data
-
Gene name
PB1
- Application
-
Alternative Names
PB1;BAF180;PB1;Protein polybromo-1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11712
-
Expression Region
1-162aa
-
AA Sequence
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG
-
Molecular Weight
25.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PB1 recombinant protein plays a critical role in various scientific and medical research fields, particularly in virology and vaccine development. The PB1 protein, a component of the RNA-dependent RNA polymerase complex in the influenza virus, is essential for viral replication and transcription. Understanding the structure and function of PB1 is crucial not only for deciphering the viral life cycle but also for developing antiviral strategies. Researchers have focused on the expression and characterization of PB1 as a recombinant protein to facilitate studies on its interaction with other viral proteins, host factors, and potential inhibitors. This approach enables the evaluation of PB1 as a target for therapeutic interventions and provides insights into the mechanisms of influenza virus pathogenesis. Advances in recombinant protein technologies have made it feasible to produce PB1 in significant quantities, allowing for high-throughput screenings and structural analyses. As the influenza virus continues to pose public health threats due to seasonal outbreaks and pandemics, understanding PB1’s function and its role in the virus’s lifecycle remains a priority. Consequently, ongoing research on PB1 recombinant protein not only enhances our understanding of influenza virus biology but also aids in the development of more effective vaccines and antiviral agents, ultimately contributing to global health security.











