Cat: PA2000-4313

Recombinant Human PB1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    PB1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    PB1;BAF180;PB1;Protein polybromo-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P11712

  • Expression Region

    1-162aa

  • AA Sequence

    MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKGG

  • Molecular Weight

    25.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

PB1 recombinant protein plays a critical role in various scientific and medical research fields, particularly in virology and vaccine development. The PB1 protein, a component of the RNA-dependent RNA polymerase complex in the influenza virus, is essential for viral replication and transcription. Understanding the structure and function of PB1 is crucial not only for deciphering the viral life cycle but also for developing antiviral strategies. Researchers have focused on the expression and characterization of PB1 as a recombinant protein to facilitate studies on its interaction with other viral proteins, host factors, and potential inhibitors. This approach enables the evaluation of PB1 as a target for therapeutic interventions and provides insights into the mechanisms of influenza virus pathogenesis. Advances in recombinant protein technologies have made it feasible to produce PB1 in significant quantities, allowing for high-throughput screenings and structural analyses. As the influenza virus continues to pose public health threats due to seasonal outbreaks and pandemics, understanding PB1’s function and its role in the virus’s lifecycle remains a priority. Consequently, ongoing research on PB1 recombinant protein not only enhances our understanding of influenza virus biology but also aids in the development of more effective vaccines and antiviral agents, ultimately contributing to global health security.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US