Analytical Data
-
Gene name
LAMC2
- Application
-
Alternative Names
LAMC2；LAMB2T；LAMNB2；Laminin subunit gamma-2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13753
-
Expression Region
417-588aa
-
AA Sequence
NCQGGGACDPDTGDCYSGDENPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVVCNNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLKCIHNTAGIYCDQCKAGYFGDPLAPNPADKCRACNCNPMGSEPVGCRSD
-
Molecular Weight
19.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LAMC2, or laminin subunit gamma-2, is a crucial component of the extracellular matrix (ECM), predominantly found in basement membranes. It plays a pivotal role in cell adhesion, differentiation, and signaling, which are essential for tissue development and integrity. Mutations in the LAMC2 gene have been linked to various genetic disorders, including certain forms of epidermolysis bullosa, which highlights its significance in skin integrity and wound healing. The study of recombinant LAMC2 protein is essential for understanding its structural and functional properties in the ECM, as well as its interactions with other laminin subunits and cellular receptors. By generating recombinant LAMC2, researchers can conduct detailed analyses of its role in cellular processes, elucidate mechanisms involved in disease states, and explore potential therapeutic applications. Additionally, recombinant LAMC2 can be used in drug delivery systems, tissue engineering, and regenerative medicine, showcasing its potential for significant advancements in biomedical research. Overall, the exploration of LAMC2 through recombinant protein technology offers valuable insights into its biological function and therapeutic potential, making it an important focus of current scientific investigation.
