Cat: PA1000-1475

Recombinant Human HNRNPC Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HNRNPC

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HNRNPC;HNRPC;Heterogeneous nuclear ribonucleoProteins C1/C2

  • Species

    Human

  • Source

    E. coli

  • Tag

    N-6His

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P07910

  • Expression Region

    1-293aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMASNVTNKTDPRSMNSRVFIGNLNTLVVKK SDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIAGQVL DINLAAEPKVNRGKAGVKRSAAEMYGSSFDLDYDFQRDYYDRMYSYPARV PPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSKSGKLKGDDL QAIKKELTQIKQKVDSLLENLEKIEKEQSKQAVEMKNDKSEEEQSSSSVK KDETNVKMESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEG EDDRDSANGEDDS

  • Molecular Weight

    45 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

The HNRNPC protein, or heterogeneous nuclear ribonucleoprotein C, is a crucial component of the spliceosomal machinery involved in pre-mRNA processing. It plays a significant role in the regulation of gene expression, influencing alternative splicing and mRNA stability. Research into HNRNPC has gained momentum due to its involvement in various cellular processes and implications in human diseases, particularly cancers and neurodegenerative disorders. Its function in organizing RNA metabolism and modulating interactions between RNA and proteins makes it a key player in the post-transcriptional regulation of gene expression. Additionally, emerging studies suggest that alterations in HNRNPC expression and function may contribute to disease pathogenesis, highlighting the need for a deeper understanding of its biological roles. The recombinant expression and characterization of HNRNPC provide significant insights into its structure and function, enabling researchers to investigate its mechanisms and potential as a therapeutic target. Overall, HNRNPC represents a pivotal focus in molecular biology and biomedical research, revealing important connections between RNA processing and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US