Cat: PA2000-214DB

Recombinant Human IL20 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL20

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL20;ZCYTO10;Interleukin-20

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NYY1

  • Expression Region

    25-176aa

  • AA Sequence

    LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDT KPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLR LCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEE TE

  • Molecular Weight

    17 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL-20, a member of the interleukin-10 (IL-10) family of cytokines, plays a crucial role in the regulation of immune responses and inflammation. It is primarily produced by activated macrophages and keratinocytes, and is involved in various physiological and pathological processes, including skin disorders such as psoriasis, atopic dermatitis, and inflammatory bowel diseases. The significance of IL-20 is underscored by its ability to promote keratinocyte proliferation and differentiation, as well as its involvement in the inflammatory pathways that can exacerbate chronic conditions. Given its pivotal role in mediating inflammatory responses, researchers have focused on recombinant IL-20 proteins to investigate their therapeutic potential. Developing recombinant IL-20 allows for studying its biological functions more extensively and exploring its role in disease mechanisms. Moreover, IL-20's interaction with its receptors, IL-20R1 and IL-20R2, opens avenues for targeted treatments aimed at modulating immune responses in various inflammatory diseases. Understanding the structure-function relationship of IL-20 through recombinant technology can lead to innovative strategies for developing new therapies that either inhibit its action to reduce inflammation or utilize its effects to promote wound healing. As research progresses, recombinant IL-20 is poised to play a significant role in advancing our approach to treating immune-mediated diseases and improving patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US