Analytical Data
-
Gene name
ideZ
- Application
-
Alternative Names
ideZ；
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q0PIW1
-
Expression Region
35-349aa
-
AA Sequence
DDYQRNAAEVYAKEVPHQITSVWTKGVTPLTPEQFRYNNEDVIHAPYLAHQGWYDITKVFDGKDNLLCGAATAGNMLHWWFDQNKTEIEAYLSKHPEKQKIIFNNQELFDLKAAIDTKDSQTNSQLFNYFRDKAFPNLSARQLGVMPDLVLDMFINGYYLNVFKTQSTDVNRPYQDKDKRGGIFDAVFTRGDQTTLLTARHDLKNKGLNDISTIIKQELTEGRALALSHTYANVSISHVINLWGADFNAEGNLEAIYVTDSDANASIGMKKYFVGINAHGHVAISAKKIEGENIGAQVLGLFTLSSGKDIWQKLS
-
Molecular Weight
37.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IdeZ is a bacterial protease derived from the bacterium *Ruminococcus gnavus*, known for its ability to specifically cleave antibodies at the hinge region. This unique property makes IdeZ a valuable tool in therapeutic and diagnostic applications, particularly in the field of immunology. Research into IdeZ has gained momentum due to its potential to create antibody fragments that retain the binding affinity of the intact antibody while eliminating unwanted effector functions, thus reducing immunogenicity in therapeutic contexts. Furthermore, the production of IdeZ recombinantly in host systems allows for enhanced yields and purity, making it a desirable candidate for harnessing in various biotechnological applications. Studies have also focused on optimizing the enzymatic activity and specificity of IdeZ, with the goal of improving its efficiency for use in bioconjugation and targeted drug delivery systems. As the demand for precision medicine grows, IdeZ-based innovations are being explored to develop novel therapeutic strategies that can modulate the immune response with greater accuracy, highlighting its significance in current biopharmaceutical research. This underscores the necessity for continued exploration and characterization of IdeZ as a powerful protein engineering tool in the fight against various diseases.
