Analytical Data
-
Gene name
NFkB
- Application
-
Alternative Names
NFkB；Nuclear factor NF-kappa-B p105 subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y6Q6
-
Expression Region
28-202aa
-
AA Sequence
LQIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK
-
Molecular Weight
23.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Nuclear Factor kappa B (NF-κB) is a pivotal transcription factor that plays a crucial role in regulating various biological processes, including inflammation, immunity, cell proliferation, and apoptosis. Dysregulation of NF-κB signaling is implicated in numerous diseases, particularly chronic inflammatory conditions and cancer. Consequently, understanding the molecular mechanisms governing NF-κB activity has been a focal point in biomedical research. The study of NF-κB recombinant proteins has emerged as a powerful tool to dissect its complex signaling pathways. By expressing and purifying recombinant NF-κB components, researchers can investigate their roles in cellular processes, interactions with other proteins, and their regulatory mechanisms in detail. Additionally, these recombinant proteins are invaluable in screening for potential therapeutic compounds that could modulate NF-κB activity, offering promising strategies for treating diseases characterized by NF-κB dysregulation. Overall, the research into NF-κB recombinant proteins not only enhances our understanding of fundamental biological processes but also paves the way for novel therapeutic interventions aimed at diseases associated with NF-κB signaling.
