Analytical Data
-
Gene name
IBRDC2
- Application
-
Alternative Names
RNF144B; IBRDC2; P53RFP; E3 ubiquitin-protein ligase RNF144B; IBR domain-containing protein 2; RING finger protein 144B; p53-inducible RING finger protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q7Z419
-
Expression Region
1-302aa
-
AA Sequence
MGSAGRLHYLAMTAENPTPGDLAPAPLITCKLCLCEQSLDKMTTLQECQCIFCTACLKQYMQLAIREGCGSPITCPDMVCLNHGTLQEAEIACLVPVDQFQLYQRLKFEREVHLDPYRTWCPVADCQTVCPVASSDPGQPVLVECPSCHLKFCSCCKDAWHAEVSCRDSQPIVLPTEHRALFGTDAEAPIKQCPVCRVYIERNEGCAQMMCKNCKHTFCWYCLQNLDNDIFLRHYDKGPCRNKLGHSRASVMWNRTQVVGILVGLGIIALVTSPLLLASPCIICCVCKSCRGKKKKHDPSTT
-
Molecular Weight
60 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The IBRDC2 protein, a member of the immune response family, has garnered significant research interest due to its potential role in modulating immune responses and influencing various biological processes. Initially identified in studies focused on innate immunity, IBRDC2 is believed to play a crucial role in recognizing pathogens and mediating the inflammatory response. Its reconstitution and characterization as a recombinant protein have opened new avenues for understanding its functional mechanisms. Previous studies suggest that IBRDC2 may interact with specific receptors and signaling pathways that regulate gene expression in response to immune challenges. Additionally, its involvement in diseases such as autoimmune disorders and cancers highlights its importance in medical research. The recombinant form of IBRDC2 allows for detailed structural and functional analysis, facilitating investigations into its therapeutic potential. This includes evaluating its capacity to enhance vaccine efficacy or serve as a biomarker for disease diagnosis. As researchers delve into the intricate dynamics of the immune system, IBRDC2 emerges as a significant protein whose study could lead to breakthroughs in immunotherapy and disease management. These insights underscore the importance of IBRDC2 in both fundamental and applied biomedical research, paving the way for novel strategies to harness the immune system in disease prevention and treatment.
