Cat: PA2000-182DB

Recombinant Human DEFa1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    DEFa1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DEFa1;DEF1;DEFA2;MRS;Neutrophil defensin 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P59665

  • Expression Region

    1-94aa

  • AA Sequence

    MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC

  • Molecular Weight

    37.2kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

DEFa1 (Defensin alpha 1) is a member of the defensin family of antimicrobial peptides, which play a crucial role in the innate immune system. These small, cationic peptides are primarily expressed in neutrophils and epithelial cells, contributing to the first line of defense against various pathogens, including bacteria, viruses, and fungi. Research on DEFa1 has gained significant attention due to its potent antimicrobial properties and its involvement in various inflammatory processes. Studies have shown that DEFa1 not only exerts direct antimicrobial effects but also modulates immune responses by influencing cell signaling pathways and attracting immune cells to sites of infection. Dysregulation of DEFa1 expression has been implicated in several diseases, including autoimmune disorders and chronic inflammatory conditions, highlighting its potential as a therapeutic target. Recent advances in recombinant protein technology have facilitated the production and study of DEFa1, allowing researchers to investigate its structure-function relationships and develop novel antimicrobial agents based on its mechanism of action. This research is crucial for understanding the role of DEFa1 in host defense and for the development of new strategies to combat antibiotic resistance and improve health outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US