Analytical Data
-
Gene name
DEFa1
- Application
-
Alternative Names
DEFa1;DEF1;DEFA2;MRS;Neutrophil defensin 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P59665
-
Expression Region
1-94aa
-
AA Sequence
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC
-
Molecular Weight
37.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DEFa1 (Defensin alpha 1) is a member of the defensin family of antimicrobial peptides, which play a crucial role in the innate immune system. These small, cationic peptides are primarily expressed in neutrophils and epithelial cells, contributing to the first line of defense against various pathogens, including bacteria, viruses, and fungi. Research on DEFa1 has gained significant attention due to its potent antimicrobial properties and its involvement in various inflammatory processes. Studies have shown that DEFa1 not only exerts direct antimicrobial effects but also modulates immune responses by influencing cell signaling pathways and attracting immune cells to sites of infection. Dysregulation of DEFa1 expression has been implicated in several diseases, including autoimmune disorders and chronic inflammatory conditions, highlighting its potential as a therapeutic target. Recent advances in recombinant protein technology have facilitated the production and study of DEFa1, allowing researchers to investigate its structure-function relationships and develop novel antimicrobial agents based on its mechanism of action. This research is crucial for understanding the role of DEFa1 in host defense and for the development of new strategies to combat antibiotic resistance and improve health outcomes.











