Cat: PA1000-1435

Recombinant Human HEXIM1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HEXIM1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HEXIM1;CLP1;EDG1;HIS1;Protein HEXIM1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O94992

  • Expression Region

    1-359aa

  • AA Sequence

    MAEPFLSEYQHQPQTSNCTGAAAVQEELNPERPPGAEERVPEEDSRWQSR AFPQLGGRPGPEGEGSLESQPPPLQTQACPESSCLREGEKGQNGDDSSAG GDFPPPAEVEPTPEAELLAQPCHDSEASKLGAPAAGGEEEWGQQQRQLGK KKHRRRPSKKKRHWKPYYKLTWEEKKKFDEKQSLRASRIRAEMFAKGQPV APYNTTQFLMDDHDQEEPDLKTGLYSKRAAAKSDDTSDDDFMEEGGEEDG GSDGMGGDGSEFLQRDFSETYERYHTESLQNMSKQELIKEYLELEKCLSR MEDENNRLRLESKRLGGDDARVRELELELDRLRAENLQLLTENELHRQQE RAPLSKFGD

  • Molecular Weight

    65 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HEXIM1 (Hexamethylenebisacetamide-Inducible Protein 1) is a critical regulator of gene expression, primarily known for its role in the control of transcription mediated by the positive transcription elongation factor b (P-TEFb). Recent studies have highlighted the importance of HEXIM1 in various cellular processes, including differentiation, proliferation, and response to stress signals. Originally identified as a protein that can inhibit P-TEFb, HEXIM1's function extends to modulating RNA polymerase II activity and influencing the expression of several genes, including those involved in viral infections and cancer. Given its diverse roles, HEXIM1 has garnered attention as a potential therapeutic target. Research into its recombinant protein form aims to elucidate its structure-function relationship and regulatory mechanisms. By producing HEXIM1 as a recombinant protein, scientists can investigate its interactions with other proteins, analyze its role in transcriptional regulation, and explore its potential in clinical applications, such as antiviral therapies and cancer treatment. Understanding the biochemical properties of HEXIM1 may provide insights into the dysregulation of transcriptional processes observed in various diseases, paving the way for the development of novel therapeutic strategies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US