Cat: PA2000-180DB

Recombinant Human IL28A Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL28A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL28A;IL28A;ZCYTO20;;Interferon lambda-2

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q8IZJ0

  • Expression Region

    26-200aa

  • AA Sequence

    VPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRC HSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALVDVLDQ PLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLE ASVTFNLFRLLTRDLNCVASGDLCV

  • Molecular Weight

    20 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

IL28A, a member of the interferon lambda family, plays a critical role in the immune response, particularly in the context of viral infections and autoimmune diseases. Its ability to modulate the innate immune response has drawn significant attention in medical research, especially concerning its therapeutic potential. Researchers have been exploring IL28A recombinant proteins for their application in antiviral therapy, particularly for hepatitis C virus (HCV) treatment, as IL28A has been associated with favorable outcomes in response to therapy. The study of IL28A has revealed its mechanisms of action, including the activation of signaling pathways that lead to the expression of antiviral genes, enhancing the host's defense mechanisms. Additionally, genetic studies have highlighted polymorphisms in the IL28A gene that influence individual responses to both infection and treatment, underscoring its importance in personalized medicine. As a result, recombinant IL28A proteins are being investigated not only for their direct antiviral properties but also for their potential to synergize with other therapeutic agents. Given the increasing burden of viral diseases globally, understanding and leveraging IL28A's functions through recombinant technology could pave the way for novel treatment strategies and improve patient outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US