Analytical Data
-
Gene name
CD11b
- Application
-
Alternative Names
CD11b；CDC2L1；CDK11；PITSLREA；Cyclin-dependent kinase 11B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P11215
-
Expression Region
567-825aa
-
AA Sequence
HSQRIAGSKLSPRLQYFGQSLSGGQDLTMDGLVDLTVGAQGHVLLLRSQPVLRVKAIMEFNPREVARNVFECNDQVVKGKEAGEVRVCLHVQKSTRDRLREGQIQSVVTYDLALDSGRPHSRAVFNETKNSTRRQTQVLGLTQTCETLKLQLPNCIEDPVSPIVLRLNFSLVGTPLSAFGNLRPVLAEDAQRLFTALFPFEKNCGNDNICQDDLSITFSFMSLDCLVVGGPREFNVTVTVRNDGEDSYRTQVTFFFPLD
-
Molecular Weight
29 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CD11b, a member of the beta 2 integrin family, plays a pivotal role in the immune response by facilitating leukocyte adhesion and migration to sites of inflammation. It is predominantly expressed on myeloid cells, including monocytes, macrophages, and granulocytes, where it interacts with various ligands such as ICAM-1 and fibrinogen, promoting cell adhesion and phagocytosis. Given its key functions in immune regulation, CD11b has been implicated in numerous pathological conditions, including autoimmune diseases, cancer, and infectious diseases. The generation of recombinant CD11b proteins has enabled researchers to study its structure-function relationships and to explore its potential as a therapeutic target. Recent advances in recombinant protein technology have facilitated the production of CD11b in various systems, allowing for detailed characterization of its binding properties and signaling pathways. Additionally, the use of CD11b-targeting antibodies in clinical settings highlights the protein's importance as a biomarker and therapeutic target in diseases characterized by dysregulated immune responses. Understanding the biology of CD11b through recombinant proteins may lead to novel strategies for modulating immune functions and improving treatment outcomes in a variety of immune-related disorders.
