Analytical Data
-
Gene name
S375SLEH
- Application
-
Alternative Names
S375SLEH；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P35659
-
Expression Region
309-375aa
-
AA Sequence
DEPLIKKLKKPPTDEELKETIKKLLASANLEEVTMKQICKKVYENYPTYDLTERKDFIKTTVKELISLEH
-
Molecular Weight
15.7 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The S375SLEH recombinant protein has garnered significant attention in the field of biomedicine due to its potential therapeutic applications and its role in various biological processes. The protein is derived from a unique fusion of genetic sequences, which offers insights into protein structure-function relationships. Research into S375SLEH has primarily focused on its implications in cellular signaling pathways, immune responses, and its ability to modulate protein interactions. Additionally, studies have suggested that S375SLEH may play a critical role in disease mechanisms, particularly in cancer biology and autoimmune disorders. Understanding the expression, purification, and functional characterization of this recombinant protein could pave the way for the development of novel biomolecular therapies. Furthermore, the exploration of S375SLEH’s potential as a biomarker for disease diagnosis and prognosis adds a layer of significance to its study. As researchers continue to explore the interactions and pathways influenced by S375SLEH, the findings may lead to breakthroughs in targeted treatments and personalized medicine, highlighting its importance in contemporary scientific research.
