Cat: PA1000-1429

Recombinant Human HERC5 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    HERC5

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    HERC5;CEB1;CEBP1;E3 ISG15--Protein ligase HERC5

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9UII4

  • Expression Region

    681-1024aa

  • AA Sequence

    MGSSHHHHHH SSGLVPRGSH MGSFDLTVRRNHLIEDVLNQLSQFENEDLRKELWVSFSGEIGYDLGGVKK EFFYCLFAEMIQPEYGMFMYPEGASCMWFPVKPKFEKKRYFFFGVLCGLS LFNCNVANLPFPLALFKKLLDQMPSLEDLKELSPDLGKNLQTLLDDEGDN FEEVFYIHFNVHWDRNDTNLIPNGSSITVNQTNKRDYVSKYINYIFNDSV KAVYEEFRRGFYKMCDEDIIKLFHPEELKDVIVGNTDYDWKTFEKNARYE PGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITF CCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG

  • Molecular Weight

    43 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

HERC5, a member of the HERC (Homologous to the E6-AP Carboxyl Terminus) family of E3 ubiquitin ligases, plays a pivotal role in the cellular response to stress and the regulation of various biological processes, including immune responses and protein degradation. Its involvement in the ubiquitin-proteasome system highlights its significance in modulating protein stability and function within the cell. Recent studies have revealed that HERC5 is particularly important in the context of viral infections, as it enhances the antiviral response by facilitating the ubiquitination of interferon-stimulated gene products. The understanding of HERC5's mechanisms of action and regulatory pathways can provide insight into its potential as a therapeutic target for diseases linked to immune response dysregulation or viral pathogenesis. The recombinant expression of HERC5 protein allows researchers to investigate its biochemical properties, interaction partners, and specific functionalities in isolation, paving the way for a deeper comprehension of its role in viral immunity and cellular homeostasis. As such, the recombinant HERC5 protein is a valuable tool for elucidating the intricacies of the ubiquitin-proteasome system and may inform the development of novel antiviral strategies or interventions in immune-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US