Analytical Data
-
Gene name
HDGF
- Application
-
Alternative Names
HDGF;HMG1L2;Hepatoma-derived growth factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51858
-
Expression Region
1-240aa
-
AA Sequence
MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFF GTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGY QSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNE KGALKRRAGDLLEDSPKRPKEAENPEGEEKEAATLEVERPLPMEVEKNST PSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL
-
Molecular Weight
53 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HDGF (Hepatoma-Derived Growth Factor) is a crucial protein that has gained attention in recent years due to its significant role in various cellular processes, including cell proliferation, survival, and migration. Initially identified in hepatocellular carcinoma, HDGF has been linked to tumorigenesis and is often overexpressed in various cancers, suggesting its potential as a biomarker for cancer diagnosis and prognosis. Research has shown that HDGF interacts with several signaling pathways, influencing key processes such as angiogenesis and tissue repair. Moreover, the protein is involved in the regulation of stem cell properties, making it a point of interest in regenerative medicine. Recent studies have focused on the recombinant production of HDGF to better understand its structure-function relationship and biological activity. The recombinant form allows for detailed investigations into its mechanisms of action and interactions with other cellular entities. As a result, the exploration of HDGF as a therapeutic target has become a significant area of research, with implications for developing innovative cancer treatments and enhancing tissue regeneration strategies. Understanding the nuances of HDGF biology and its interplay with different cellular contexts could provide valuable insights for therapeutic advancements in oncology and regenerative medicine. The ongoing studies aim to elucidate the full potential of HDGF, thereby paving the way for new strategies in managing cancer and tissue repair scenarios.
